PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G016600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 184aa    MW: 20785.2 Da    PI: 7.7498
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G016600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.7e-193992356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       k+ ++tkeq++ Lee F++nr ++a+++  LA +lgL+ rqV vWFqNrRa+ k
  Aqcoe3G016600.2.p 39 KKLRLTKEQTDLLEESFKQNRVLNAKQKDALAFQLGLKPRQVEVWFQNRRARTK 92
                       56789***********************************************98 PP

2HD-ZIP_I/II113.11.8e-3638127191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        +kk+rl+keq  lLEesF++++ L+ ++K +la +Lgl+prqv+vWFqnrRARtk+kq+E+++e+Lk ++ +l+een+rL++e e+Lr +l
  Aqcoe3G016600.2.p  38 NKKLRLTKEQTDLLEESFKQNRVLNAKQKDALAFQLGLKPRQVEVWFQNRRARTKLKQTEMECEYLKICFTTLTEENKRLQREAEQLR-AL 127
                        59*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-181595IPR009057Homeodomain-like
SuperFamilySSF466892.09E-192695IPR009057Homeodomain-like
PROSITE profilePS5007116.8923494IPR001356Homeobox domain
SMARTSM003895.1E-163698IPR001356Homeobox domain
PfamPF000469.0E-173992IPR001356Homeobox domain
CDDcd000862.53E-133995No hitNo description
PRINTSPR000314.0E-56574IPR000047Helix-turn-helix motif
PROSITE patternPS0002706992IPR017970Homeobox, conserved site
PRINTSPR000314.0E-57490IPR000047Helix-turn-helix motif
PfamPF021833.4E-794127IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.2E-1594137IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MEEDQESWLA KANDDKYEEQ DSGGGGGGGG GDGYGSSNKK LRLTKEQTDL LEESFKQNRV  60
LNAKQKDALA FQLGLKPRQV EVWFQNRRAR TKLKQTEMEC EYLKICFTTL TEENKRLQRE  120
AEQLRALRRV GQPPNNCEPL PAESTLTMCP RCERVTSRSS SSTSNELRHS PQPSAYCPEV  180
LRI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18694RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014508300.11e-60PREDICTED: homeobox-leucine zipper protein HOX3
SwissprotQ0JKX11e-53HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH381e-53HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A0L9VAC13e-60A0A0L9VAC1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R2Y82e-60A0A0S3R2Y8_PHAAN; Uncharacterized protein
STRINGGLYMA20G01770.12e-56(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.15e-46homeobox-leucine zipper protein 17